SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400043209 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400043209
Domain Number 1 Region: 4-370
Classification Level Classification E-value
Superfamily Translation proteins 1.32e-111
Family Ribosomal protein L3 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400043209
Sequence length 389
Comment PGSC0003DMT400064116
Sequence
MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPTKPCRLTAFLGYKAGMTHIVREV
EKPGSKLHKKETCEAVTIIETPPMIVVGVVGYVKTPRGLRCLSTVWAQHLSEEIKRRFYK
NWCMSKKKAFAKYSKKYETDEGKKDINAQLEKMKKYCSVIRVLAHTQIRKMKGLKQKKAH
LMEIQVNGGDVAQKVDYAYGFFEKQIPIDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYRLGKAGQESHSAIT
EFDRTEKEITPIGGFPHYGVVKEDFLLIKGCCVGPKKRVVTLRQSLLNQTSRVALEEIKL
KFIDTSSKFGHGRFQTTQEKAKFYGRLKA
Download sequence
Identical sequences M1CBS3
XP_006349325.1.80749 XP_006349326.1.80749 PGSC0003DMP400043209 PGSC0003DMP400043211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]