SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400043343 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400043343
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.03e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00053
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400043343
Domain Number - Region: 70-111
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00296
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400043343
Sequence length 113
Comment PGSC0003DMT400064279
Sequence
MVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLIKISSDSESTITPLPH
MFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAPTPGKEIPQSKSDRAKLDGMYE
Download sequence
Identical sequences M1CC30
PGSC0003DMP400043343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]