SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400045160 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400045160
Domain Number 1 Region: 68-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-97
Family G proteins 0.000000219
Further Details:      
 
Domain Number 2 Region: 540-662
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-37
Family Translational machinery components 0.0000468
Further Details:      
 
Domain Number 3 Region: 311-338,368-463
Classification Level Classification E-value
Superfamily Translation proteins 7.29e-28
Family Elongation factors 0.00042
Further Details:      
 
Domain Number 4 Region: 666-755
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.67e-24
Family EF-G/eEF-2 domains III and V 0.00049
Further Details:      
 
Domain Number 5 Region: 463-540
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.47e-22
Family EF-G/eEF-2 domains III and V 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400045160
Sequence length 760
Comment PGSC0003DMT400066962
Sequence
MARSARSSTTRLFYTLCSSTKRTPLTPQHPPPTPVAALLAGNFQLRHYAAGSATARVREE
KDAVWRESLEKVRNIGISAHIDSGKTTLTERVLFYTGRIHEIHEVRGKDGVGAKMDSMDL
EREKGITIQSAATYCTWKDYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQ
SITVDRQMRRYDVPRLAFINKLDRMGADPWKVLNQARSKLRHHSAAVQVPIGLEDDFKGL
IDLVQSKAYYFHGSNGEKIVTEDIPADMEAITSEKRRELIEAVSEVDDKLAESFLNDEPI
SSADLEAAIRRATIARKFVPFFMGSAFKNKGVQTLLDGVLSYLPCPVEVSNYALDQTKDE
EKVTLTGNPSGPLVALAFKLEEGRFGQLTYLRIYEGVIRKGDFIINVNTGKKIKIPRLVR
MHSNEMEDIQEAHAGQIVAVFGVDCASGDTFTDGSVKYTMTSMNVPEPVMSLAVSPVSKD
SGGQFSKALNRFQKEDPTFRVGLDAESGETIISGMGELHLDIYVERIRREYKVEAQVGKP
RVNFRETITKRADFDYLHKKQSGGQGQYGRVIGYVEPLEPGSGSKFEFENMLVGQTVPSN
YVPAIEKGFREAANSGSLIGHPVENIRVVLTDGASHNVDSSELAFKLASIYAFRQCYTAA
KPIILEPVMLVDIKVPTEFQGTVTGDINKRKGVIIGNDQEGDDSVITANVPLNMMFGYST
SLRSMTQGKGEFTMEYREHAPVSGDTQTQLVNTYKASKES
Download sequence
Identical sequences M1CGG0
XP_006347922.1.80749 PGSC0003DMP400045160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]