SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400047244 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400047244
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily Translation proteins 2.24e-35
Family Ribosomal protein L35ae 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400047244
Sequence length 112
Comment PGSC0003DMT400069912
Sequence
MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKRMAYVYKA
KTKKKNSHYRCIWGKVCRPHGNSGVVRAKFKSNLPPKSMGAKVRVFMYPSNI
Download sequence
Identical sequences M1CLD2
PGSC0003DMP400047243 PGSC0003DMP400047244 XP_006355672.1.80749 XP_015167943.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]