SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400047430 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400047430
Domain Number 1 Region: 84-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-58
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 247-369
Classification Level Classification E-value
Superfamily Translation proteins 6.24e-30
Family Elongation factors 0.0051
Further Details:      
 
Domain Number 3 Region: 481-576
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.71e-23
Family EF-G/eEF-2 domains III and V 0.0087
Further Details:      
 
Domain Number 4 Region: 374-452
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.27e-19
Family EF-G/eEF-2 domains III and V 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400047430
Sequence length 682
Comment PGSC0003DMT400070154
Sequence
MATANFCRPKFIHHYHHQHQNCFNLPTNLYFSNHLKSKRSDGAQSVRRRRQRWRSSLRVH
CQAAATDIEATARAGKDRLLKVPISNIRNFSIIAHIDHGKSTLADKLLQMTGTVESRDMK
EQFLDNMDLERERGITIKLQAARMRFIYENEPYCLNLIDTPGHVDFSYEVSRSLAACEGA
LLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGADPARVCQEIEEIVGLDCSNA
IYTSAKEGIGITEILNAIVQRIPPPRDTAERPLRALIFDSYYDPYRGVIVYFRIIDGTIK
KGDRVLFMASGKDYYADELGVLSPNQLQVDQLYAGEVGFLSASIRSVADARVGDTITHFQ
RKAEQSLPGYKEATPMVFCGLFPVDADQFSELRDALEKLQLNDAALKFEPETSSAMGFGF
RCGFLGLLHMEIVQERLEREYNLSLITTAPSVVYRVNCIDGDTVECSNPSLLPEPGNRRS
IEEPFVKIELLTPKEYIGALMELAQDRRGIFKEMKYITENRASIIYELPLAEMVGDFFDQ
LKSRSKGYASMEYNFIGYTESDLIKLDILINGDRVEPLATIVHKDKAYSVGRALTQKLKE
LIPRQMFKVPIQATIGSKVIASEAISAIRKDVLAKCYGGDISRKKKLLKKQAEGKKRMKA
IGKVDVPQEAFMAVLKLEKEVL
Download sequence
Identical sequences M1CLR3
XP_006350216.1.80749 PGSC0003DMP400047430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]