SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400047431 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400047431
Domain Number 1 Region: 174-269
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.59e-23
Family EF-G/eEF-2 domains III and V 0.0087
Further Details:      
 
Domain Number 2 Region: 67-145
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-19
Family EF-G/eEF-2 domains III and V 0.0048
Further Details:      
 
Domain Number 3 Region: 4-63
Classification Level Classification E-value
Superfamily Translation proteins 0.0000434
Family Elongation factors 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400047431
Sequence length 375
Comment PGSC0003DMT400070155
Sequence
MASGKDYYADELGVLSPNQLQVDQLYAGEVGFLSASIRSVADARVGDTITHFQRKAEQSL
PGYKEATPMVFCGLFPVDADQFSELRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGL
LHMEIVQERLEREYNLSLITTAPSVVYRVNCIDGDTVECSNPSLLPEPGNRRSIEEPFVK
IELLTPKEYIGALMELAQDRRGIFKEMKYITENRASIIYELPLAEMVGDFFDQLKSRSKG
YASMEYNFIGYTESDLIKLDILINGDRVEPLATIVHKDKAYSVGRALTQKLKELIPRQMF
KVPIQATIGSKVIASEAISAIRKDVLAKCYGGDISRKKKLLKKQAEGKKRMKAIGKVDVP
QEAFMAVLKLEKEVL
Download sequence
Identical sequences M1CLR4
PGSC0003DMP400047431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]