SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400048451 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400048451
Domain Number 1 Region: 103-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-59
Family G proteins 0.00000756
Further Details:      
 
Domain Number 2 Region: 429-559
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 4.32e-35
Family Initiation factor IF2/eIF5b, domain 3 0.00018
Further Details:      
 
Domain Number 3 Region: 563-700
Classification Level Classification E-value
Superfamily Translation proteins 1.2e-23
Family Elongation factors 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400048451
Sequence length 701
Comment PGSC0003DMT400071616
Sequence
MQENQEEIVSLEREEVKDINSASIEEKSEVVDAKSWDDAADLNMPGKSAFEDEEIDSDPQ
PIIKKEIKATRSAPTIPENAGSKKREPDVGVSEETSGQCEYNLRSPICCIMGHVDTGKTK
LLDCIRGTNVQEGEAGGITQQIGATYFPAENICERTKELKADANLKVPGLLVIDTPGHES
FTNLRSRGSGLCDIAILVVDIMHGLERHTIESLNLLKMRNTNFIIALNKVDRLYGWKVCH
NASIVKAMKQQSKDVQFEFRTRLTQVITEFKEQGINTELYYKNKDMGKGTFSIVPTSAIS
AEGIPDLLLLLVQWTAKTMSERLTYNNIVQCTVLEVKVVEGLGTTIDVILVNGVLHEGDQ
IVVCGMQGPIVTSIRALLTPFPMKELRVKGSYEHHKEIKASQGIKINAQGLEHAIAGTSL
YIVGPDDDVEDIKEAAMKDMRSVMSRVDKCGEGVYVQASTLGSLEALLEFLKTPEVSIPV
SGIGIGNVHKKDVMKASVMLEKKKEYATILAFDVRVTQEAQELADEVGVKIYTADIIYHL
FDQFKAHIDNLKEEKRKEVAEEVVFPCMLKIVPNCVFNKKDPIVLGVEVLEGIAKVGTPI
CIRQCLVDIGWIASIKNNGKPVDSAKKGQKVSIKIIGSNTEEQQKMFGRHFDIEDELVSK
ISRRSIDILKADFRVHATLQKDLSVEDWKLVLILKALFKIQ
Download sequence
Identical sequences M1CP22
PGSC0003DMP400048451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]