SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400049458 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400049458
Domain Number 1 Region: 108-315
Classification Level Classification E-value
Superfamily L domain-like 6.32e-34
Family Polygalacturonase inhibiting protein PGIP 0.0058
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400049458
Domain Number - Region: 580-611
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00165
Family Rho termination factor, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400049458
Sequence length 616
Comment PGSC0003DMT400073086
Sequence
MAPFFLSLTLLLFLLSTKSSSQSTNLDPNQLKALRSLNVPTGKDPCSPLHNSTICDSSTP
FHHLISLKLINCSNDVTLSQTSLKTLSTLQDLQFINCPVSPIHFPSELSSNLQSFTCINS
LKKLTSLWLIQLCNVTSLTVSHVPVSASGPSIILNSIKNLQSVTISHANLKGVLPTKWHM
NLTYVDLSGNQLKGKIPSSLTELENLLHLNLSSNSLNGTIPNSFGNLLSLKNVSLASNAL
SGSIPKSIAAIPGLVHLDLGSNQLNGTVPKFISDMKGLKYLNLERNNFEGVLPFNASFIK
KLVVFKVGENSNLCYNHSTLSSKLKLGIAPCDKHGLPLSPPPPKEDFSDDTAEDDGPPPK
HEHGPSRVVFGVAIGLSSISTRNDNTQRHCLFNLAEIAYGLSLSTNRRDFHCSTLSTIRA
DGIRRRKSSKDATPGKTSKGSELNIQPSPDSKSPNSLNQEEIISLFKRIQSSISKGDSTS
SKKRSTKSSEEKPAIDSVLEILRHSKTEPKGTKDDKGLTHQKDKKEPETDYPPTADPRST
RLRSSFVKRSPLQSPFNSKEKVELKVETSLENHVESEAVKIEEMKLPQLKELAKSRGLKG
YSKLKKSELLELLISC
Download sequence
Identical sequences M1CRI3
PGSC0003DMP400049458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]