SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400049459 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400049459
Domain Number - Region: 219-250
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000471
Family Rho termination factor, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400049459
Sequence length 255
Comment PGSC0003DMT400073089
Sequence
MGATATAVFSSNSISQFPSFSALCKPNLGIRIPKEIAYGLSLSTNRRDFHCSTLSTIRAD
GIRRRKSSKDATPGKTSKGSELNIQPSPDSKSPNSLNQEEIISLFKRIQSSISKGDSTSS
KKRSTKSSEEKPAIDSVLEILRHSKTEPKGTKDDKGLTHQKDKKEPETDYPPTADPRSTR
LRSSFVKRSPLQSPFNSKEKVELKVETSLENHVESEAVKIEEMKLPQLKELAKSRGLKGY
SKLKKSELLELLISC
Download sequence
Identical sequences M1CRI4
XP_006358113.1.80749 PGSC0003DMP400049459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]