SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400051855 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400051855
Domain Number 1 Region: 4-370
Classification Level Classification E-value
Superfamily Translation proteins 3e-110
Family Ribosomal protein L3 0.00000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400051855
Sequence length 389
Comment PGSC0003DMT400076546
Sequence
MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCKLTAFLGYKAGMTHIVREV
EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLSEDIKRRFYK
NWCKSKKKAFLKYSKKYETDEGKKDIQAQLEKLKKYACVIRVLAHTQIRKMKGLKQKKAH
LMEIQVNGGSIAQKVDFAYGFFEKQVPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKVGQESHTAVT
EFDRTEKEITPIGGFAHYGVVKDDYLLIKGCCVGPKKRVVTLRQSLLNQTSRVALEEIKL
KFIDTSSKFGHGRFQTTQEKQKFYGRLKA
Download sequence
Identical sequences Q2VCJ2
NP_001275276.1.80749 PGSC0003DMP400051855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]