SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400051973 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400051973
Domain Number - Region: 243-275
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0981
Family Rho termination factor, N-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400051973
Sequence length 285
Comment PGSC0003DMT400076700
Sequence
DVIEADALNKKSCLQVLEIQANKADSEIGELEDDKLMIQRQLACEDNMGFAALNNLESML
KPLKNENQQLAGTTLAERHAAQQATKEYSSKSTVNGVKAVQINDPSGMKGQEVVHAGTVR
TIEGTRLRLLNSIRGDRSNPQRKLMGGGEYYGDNTIRGTQQHLAGAKRAGGFAGISATSQ
FHFRRRSETSFCVPVVQENNNQRNAQNMLVRSHDRTSQAPRNVHNVEVVFPMRITPASCM
ACIDNMSLVQLKALANQLNIVGVSKTRKADLQQLLRSKLQAQDWS
Download sequence
Identical sequences M1CX88
PGSC0003DMP400051973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]