SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400052328 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400052328
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000637
Family Extended AAA-ATPase domain 0.059
Further Details:      
 
Domain Number 2 Region: 127-357
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000221
Family Internalin LRR domain 0.01
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400052328
Domain Number - Region: 59-133
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0667
Family Helical scaffold and wing domains of SecA 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400052328
Sequence length 357
Comment PGSC0003DMT400077241
Sequence
MESLAKDMVEKCRGLPLAIVVLSGLLSHKKGLDEWQKVKDHLWKNIIEDKYIEVSNILSL
SYSDLSTALKQCFQYFGIFPEDKVVDAENIIWLSMDEGFIPRGEERMEDVAEGFLNELIR
RSLIQVVDTVWEKFTECRVHDLLRDLAIQKALEILLRTTPETADLINLRHLDSLYSKPLK
RLSKLTSLQVLKGVLCDQWKDVEPVDLVNLRELTMHDITKTCSLNNISSLKNLSTTRLFC
EGYESFPSLEFLNCCEKLQKLWLKGRIEKLPLFPNSITMMFLRNSKLREDLMPILGMLPN
LRNLILYGAYEGKEIMCNDNSFSQLKFLCLDQLSNLKIWHLGTNVMPLINDLHIKNC
Download sequence
Identical sequences M1CY34
PGSC0003DMP400052328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]