SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400052971 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400052971
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily TSP9-like 5.62e-22
Family TSP9-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400052971
Sequence length 104
Comment PGSC0003DMT400078225
Sequence
MASLNLFVTPIAAVTTQQHRRRVYTAATASKSSGGSTEEKSLLDFILGALQKRDQLLETD
PLLNKVEDKSVSTTTTGRKNSVAVPPKKDGGGFGGFGGLFNKKE
Download sequence
Identical sequences M1CZN7
PGSC0003DMP400052971 XP_015165682.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]