SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400053532 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400053532
Domain Number 1 Region: 124-453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-84
Family G proteins 0.00000122
Further Details:      
 
Domain Number 2 Region: 674-842
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-58
Family Translational machinery components 0.0000212
Further Details:      
 
Domain Number 3 Region: 458-584
Classification Level Classification E-value
Superfamily Translation proteins 6.8e-35
Family Elongation factors 0.0003
Further Details:      
 
Domain Number 4 Region: 843-930
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.93e-27
Family EF-G/eEF-2 domains III and V 0.00018
Further Details:      
 
Domain Number 5 Region: 600-672
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000104
Family EF-G/eEF-2 domains III and V 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400053532
Sequence length 987
Comment PGSC0003DMT400078978
Sequence
MDDSLYDEFGNYIGPEIESDQESDREEEDDELPDRSDDERVASDGEQPGASNGWLATQDD
IDMDNQVILAEDKKYYPTAEEVYGEEVETLVMDEDEQPLEMPIIKPVKNLKFELGVKDSS
TYVSTQFLLGLMSNPALVRNVALVGHIHHGKTLFMDMLVEQTHHISTFDQNSEKHMRYTD
TRIDEQERRISIKSVPMSLVLEDSNSKSYLCNIMDAPGHVNFSDEMSAALRLADGAVLIV
DAVEGVMVNTERAIRHAILERIPIVLVINKVDRLITELKLPPKDAYFKLKHIVETVNNQI
TAASSTAGNAQVIDPVLGNVCFASATAGWSFTLQSFAKLYVKLHGIAFDANKFASRLWGD
FYFDPDTRSFKKKPPASGVERSFVQFVLEPLYKIYSQVIGEHKKSVEATLAELGVTLSNA
AYRLNVRPLLRLACSAVFGTATGFTDMLVHHIPSAKAAAARKVEHIYTGPKDSAIYKAME
NCDSAGPLMVNVTKLYPKPDCSVFDAFGRVYSGEIMTGQTVRVLGEGYSPDDEEDMTVKE
VTKLWVYQARYRIPISKAPPGAWVLIEGVDASIMKTATLCNLEFDEDVYIFRPLQFNTLS
VVKTATEPLNPSELPKMVEGLRKISKSYPLAITKVEESGEHTILGTGELYLDSIMKDLRE
LYSEVEVKVADPVVSFCETVVESSSMKCFAETPNKKNKITMIAEPLERGLAEDIENGVVS
IDWPRKKLGEFFQTKYDWDLLAARSIWAFGPDKQGPNILLDDTLSSEVDKSLLNAVKDSI
VQGFQWGAREGPLCDEPIRNVKFKIVDAKIAPEPLHRGTGQIIPTARRVAYSAFLMATPR
LMEPVYYVEIQTPMDCLSAIYTVLSRRRGHVTADVPQPGTPAYIVKAFLPVIESFGFETD
LRYHTQGQAFCLSVFDHWAIVPGDPLDKSIVLRPLEPAPIQHLAREFMVKTRRRKGMSED
VSINKFFDEAMMVELAQQDADLHLQMM
Download sequence
Identical sequences M1D118
XP_006359523.1.80749 XP_006359524.1.80749 PGSC0003DMP400053532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]