SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400053635 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400053635
Domain Number 1 Region: 742-1036
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.08e-63
Family G proteins 0.0000048
Further Details:      
 
Domain Number 2 Region: 1070-1200
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 3.79e-36
Family Initiation factor IF2/eIF5b, domain 3 0.00014
Further Details:      
 
Domain Number 3 Region: 1204-1336
Classification Level Classification E-value
Superfamily Translation proteins 7.57e-29
Family Elongation factors 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400053635
Sequence length 1337
Comment PGSC0003DMT400079119
Sequence
MGRKKPVRENESLESSKQGGGGGGKSKKKNRVIDDDDYSVGTELSEDTVVLEDKAELVPE
ISKKRGKKGKKSGARDEDVEETEDKLVRKEEDDEKKKLGGGEKNLAKQVGGGGKSKKKNV
AIDDDEYSIGTEISAETQEEELAPAVAFGKKKSKKGKKGGVSTSDYGSLGQDDDDEDVSG
LSRDRDGVVGDSDREAESVASVTGKTKNLRLGKSSASLSVTSAFHAIDDQDNETGQLSEE
DEESTVAFTGRSSGISFSAALLDEENDADTSLKLETEANEEDDAPGIIFSGKKKSSKKKN
KSASSTIDTAFRNDSTNVVDQDHCNLGVNREDADDNRGKKQTTDVLETSKNKTKKKKSGH
ASKILADLGEGSTITTPAQPANASLPQEEKSQQQSQLGDDTGEREAVEEAVKSAAAKKKK
KKEKEKEKKAAVAVSEMEEKQEGTKNDTRAKLADKKQSKQVREMQERLKKMKEVEESKKK
EEEERLRKEEEEHLRLEELERLAEEKKHLKKEREKEKLLKKKLEGKLLTGKQKEEARRLE
AMRKQFLASGGALPLSTGESRKDATKRPIYQSKKSKSQAWANGKVQEESVESTEVQENQQ
EIVSEVDSMKTEKAEDIDLVSVEEKSEVADAEENRVEEEEDEEEWDARSWDDADLKLPRK
SAFEDEELDSDPQPIITKAARSVVSDTGPLPVAAKSVIPTQKAVASVPDVTKNDGSKKRE
PVVVVSGKGTEKPGASSSKSEDNLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGIT
QQIGATYFPAENIRERTKELKADAKLKVPGLLVIDTPGHESFTNLRSRGSSLCDIAILVV
DIMHGLEPQTIESLNLLKMRNTEFIVALNKIDRLYGWKVCRNAPIVKAMKQQSKDVQFEF
ITRLTQIVTQFKEQGINTELYYRNKEMGKDTFSIIPTSAISGEGIPDLLLLLVQWTQKTM
VERLTYSSEVQCTVLEVKAIEGHGTTIDVVLINGMLHEGDQIIVCGMQDPIVTSIRALLT
PHPMKELRIKGSYVHHKEIKAAQGIKINAQGLEHAIAGTSLYVVGPDDDVENIKEAAMED
MRSVMSRIDRSGEGVYVQASTLGSLEALLEFLKTDEVRIPVSGIGIGPVHKKDVMKASVM
LEKKIEYATILAFDVKVTQEARELADEAGVKIFIADIIYHLFDQFKAYIDNLKEEKKKEV
AEEAVFPCSLKIVPNHVYNKKDPIVVGVDVLEGIARVGTPICIPQREFIDIGRIASIENN
HRPVDSAKKGQRVSIKIVGSNSEEKQKMFGRHFEIEDELVSKVSRRSIDILKANFRNDLS
IEDWKLVKTLRDLFKIQ
Download sequence
Identical sequences M1D1A0
PGSC0003DMP400053635 XP_006356684.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]