SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400054149 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400054149
Domain Number 1 Region: 473-655
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.26e-50
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 785-897
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 6.8e-29
Family Initiation factor IF2/eIF5b, domain 3 0.0024
Further Details:      
 
Domain Number 3 Region: 657-740
Classification Level Classification E-value
Superfamily Translation proteins 2.99e-26
Family Elongation factors 0.0083
Further Details:      
 
Domain Number 4 Region: 893-987
Classification Level Classification E-value
Superfamily Translation proteins 4.99e-25
Family Elongation factors 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400054149
Sequence length 1007
Comment PGSC0003DMT400079833
Sequence
MASLVSLGSVCGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRYVSVCRYSVTTDF
IADQGTSISLDSSSSSNKDDDADLMLKPAPKPQLKPGPRPGPVLGNGPVLSSDSDGEKRN
PIEEERSKVIESLGEALETVEKLETNRKANVSVNKASAIARTTQRNSKPVDSDDSSNRKS
KTLKSVWKKGNPIAAVQKVVKLPPKQEPMTDGGKNSESQSVAPIKPPQPPQKVQPQLLAR
PSVAPPPPVIKKPVILKDVGAAAKSSPSDGIESVGKTKELESAGKTKERKTILVDKFASK
KSAVDPMIAQAVLAPPKFGKNAPPGKFREEFRKRSGVSGGQRRRMVDDGIPDEEASEIDV
SLPGRARKGRKWTKASRKAARLKAAQESAPVKVEILEVGEEGMPTEELAYNLATSEGEIL
GLLYSKGIKPDGVQTLSNDMVKMVCKEYEVEVIDAASVKVEDMAKKKEIFDEDDLDKLED
RPPVITIMGHVDHGKTTLLDHIRKTKVAASEAGGITQGIGAYKVQVPIDTKSQICVFLDT
PGHEAFGAMRARGARVTDIAIIVVAADDGIRPQTNEAIAHAKAAGVPIVIAINKVDKDGA
NPDRVMQELSTIGLMPEDWGGDVPMVKISALKGENIDDLLETVMLVAELQELKANPQRNA
KGTVIEAGLDKSKGPVATFIVQNGTLKGGDVVVCGGAYGKVRALFDDKGKRVDEAGPSMP
VQVIGLNNVPLAGDEFEVVESLDIAREKAEERAESLRSERLSEKAGDGKITLSSFASAVS
GGTGLDLHQLNIILKVDLQGSIEAVKQALQVLPQDNVTLKFLLQATGDVSASDVDLAVAS
KAIIFGFNVRTPGSVKSYADNKGVEIRLYKVIYDLIDDVRKAMEGLLESVEEQVPIGSAE
VRAVFSSGSGRVAGCMVTEGKVVEECGIRVTRKGKVVHVGVVESLRRVKEAVKEVNAGLE
CGIGVEDFDDFEVGDILEAFNSVQKRRTLEEASASMAAALEEVGRGL
Download sequence
Identical sequences M1D2I6
PGSC0003DMP400054149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]