SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400065736 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400065736
Domain Number - Region: 156-212
Classification Level Classification E-value
Superfamily TSP9-like 0.0209
Family TSP9-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400065736
Sequence length 322
Comment PGSC0003DMT400094061
Sequence
MLVLQCPTHGLPDNVLLQYFYQSLDSLNKRLADQLLPGGLMQQPYVVAAQLLDGMTTINK
VWYTREDQVSPLTFKLSKEEIEKDHERDQNMAKIMAQLDILSKNVMGAGACGVNVVGVGC
ANPKEIKFEALYNEEVNFLANQCGGYRSNYPSQGGNQGWATDEGWKDRDREWRDRNPTWK
DGEKDRYVPPHERQKPKDSEGGRSVGSIWKKRDWREKCRLVSRKSIRRPDSHRRLIQPNL
GLGSVKLGGPKEMIGELLISSATPICITVWIPTLIRGFCKTRRGSEKNDVAKRIRRLAER
LLLRPSSAPLYSLCTALGTPPK
Download sequence
Identical sequences M1DTB4
PGSC0003DMP400065736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]