SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400022399 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400022399
Domain Number 1 Region: 69-148
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000569
Family B3 DNA binding domain 0.0088
Further Details:      
 
Domain Number 2 Region: 232-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000196
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400022399
Sequence length 381
Comment PGSC0003DMT400032915
Sequence
MSDDSGLRDQLLEKNEISDSYYHVDQQSDSMMVEEQNNDNSENDSLQTKHSKGSPVDTGT
AWVYRDENGKHLFEKQLSEDDITGDHLEIPRRLAHYIQSLKLQRRVDVGEKTRKVNLVGE
NECYYFTGQWKDFVKENQLKANKDLVLLEISQQLGPRIGYTCDQKAIDMNNPLLLRRLSR
ADVKALYIKKLSERYSFSRGGTGLIEIEPVVEMKLCSQIVYRYGGRTNGVMFIELPKKDV
EENLGRDLPLPAAGGEIALPLFDPVGNNSVEMKLLHTEMGDQYHLGGGWEVYAAKHGLLI
SDTIFLDKVTVQVGNDHDQLNTAQFSCHYEITYQRRRRGGTKDQSGPAAPANFAKDVVRV
TKISESSEYEGDSSWLQYCTP
Download sequence
Identical sequences M1AYB1
PGSC0003DMP400022399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]