SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400024049 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400024049
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-18
Family B3 DNA binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 150-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-18
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400024049
Sequence length 309
Comment PGSC0003DMT400035365
Sequence
MKIPPKKPHFFKPLQPGFKNGLKIPIGFLKYLKGNDQIEHAILRRDGNKWPTKVNDPRSE
AGWAEFVQQYDLQLGDILMFRHEGNMEFEVSIFDSTHCDREYAEYMQEGGGGGGAHTEDA
TERPMMRMIKSSTKASSPVKTATHHKSFGHFECIIREYCIRRGYLYLPRRFAIANGLINK
KCDLIIRDERQRLWNFKLSSSITQTYIIGCGWTKFFADNCLRKGDRIMFEVVTNGETPIW
KFQVTNREAPLLKFQGMFILIEPISYFFDDLYSLSYLCIILRCLYKYTSWITFYMLPKVC
KLSSFTLFT
Download sequence
Identical sequences M1B269
PGSC0003DMP400024049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]