SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400036767 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400036767
Domain Number 1 Region: 51-190
Classification Level Classification E-value
Superfamily POZ domain 5.18e-16
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 266-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.55e-16
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400036767
Sequence length 581
Comment PGSC0003DMT400054660
Sequence
MGSSAEPSSSISFTSTSNTSNGSIGIGQNTCACGGSETGSSNEIISLSKLSNNLEQLLLD
SSSEFSDAEIVVEGDSLGVHRCILAARSSFFRDLFRNENGNCGKEGKPSYSMIDILPCGK
VGYEAFRTFLSYLYSGKLKHFPPEASTCVDSLCSHDFCRPAINFHVELMYASFVFQVPEL
VSLFLRRLISFVGKAVLEDVIPILGVAFHCQLSELLTHCVDRVARSDLESTCIEKEVPFK
VAESIKLSQLKCQGDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAY
ALHYAVAYCDPKVVTEVLGLGVANVNLRNTRGYTVLHIAAMRKEPSIIVSLLTKGAHASE
ITLDGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRRNPMTRDALFSSPM
LADDLPMKLLYLENRVAFARLLFPLEAKLAMEIATAETTAEFADHLASKGSSGNLREVDL
NETPIMQKERLSKTVELGKRYFPHCSQVLDKFMEDDLPDFIFLEKGTPEEQKIKRRRFKE
LKDDVQRAFNKDKAGLHCSGLSSSSSSTTFKDGASVKARNL
Download sequence
Identical sequences M1BWP0
XP_006353069.1.80749 PGSC0003DMP400036767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]