SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400038984 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400038984
Domain Number 1 Region: 171-283,312-460
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000102
Family Tropomyosin 0.00065
Further Details:      
 
Domain Number 2 Region: 536-711
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000409
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400038984
Sequence length 1434
Comment PGSC0003DMT400057907
Sequence
MGVLEKISEVLYDNEENTVELRQKILTLILEWGCFDKDLKFPNNCLKECFTDTRESLERK
EEELELKWKKLSAARRGFAETVKLREEKLNDQEKMVERLWEEVEFERKQIGDVEEKLMGI
HAKEKELNKIQIWIRHETQALELKDQELAEKMEEFQKLQSMKKEYDVKVMGLESIKNELR
AIENNLDNVKKELKENESNLESVKKDVIFQESKLDNAKKELRVTENNLDYVKKELKENEN
NLESLKKDVTFQEGRLDSMTKELRAKESKLEVSKKEIREKENNLEFVNKALVVKGNRLDG
VKKVLRVKEGNLDYLEKELREKDKKMDYLEKELKENENNLESVKKDLTVKESKLDSVKKE
IGVEESKLEILKKEVTEKENNLEAVNKALAVKENRLDGVKKVLTLKEGSLNCVEKELREN
KKTMDYVKKELREKETNLNSMKKELAVIENMLDGMKKELTLKRSNLDVVVKELREKEKKV
DYVNKELWEKETNFDSMKKEIAVLENMPDSMKKELTLKESNLDVVRKELKEKVKNLNFVE
TELREKVNELESVKNEFKVEADNLNALRKQVESNEEILSSMKKELEHKEKFLGAMKKKLE
LQEEHLKSFSERLHLREIELDSTQEAYEQRVEVLNSKEKKLDSAEEFTKKSYEGFQSEKR
QFLIEQGLFEQRMKDVILREERNKDRLEELESREKHFEDRCRELREKEKQLNGIPNVHLK
TEATEDVTVDRVYTIVGNSAVTRFAVIMDGKSLQIFLNEHEKELDLMSDDVFEALQMSPD
PAKLVLDAMEGFYPPHLRKGETEFEGSVARRSCIFLLEQLIRASPEIQGSTRETARCIAR
DWKVKIKATEGNQDEILVFLYLLAAYNLVSFFDADELMILLEIVAKHDKFAELCRSLGMK
QNLPCFVQNLLTKQQHLEAIRYAYAFELVDHFPPTAILKDFLERVERNYVNVLEKETCSA
EEKIEAIERRVASVRAVIRCILDYKLQSQYPVEQLEETIEFLTRQKEDQAALSLICEAKR
PEQANVDQMGSTNPSIPTGTKALNSLSVSAKACACTFDHSNTMAIILMNMSGKNLQNFLN
KHSKEHKLLRSEVFSALQMSLDSDMLVLEALGGFYPPNHQREEIGLHRNIIRQSCILLLE
QLMELSREIIPEAKLKASKLAFAWKAKMMAEMENHLTILGFLLLVGCYRLSSAFDKDELE
SLYHKVAHHVNTSKICHVLGISDNTSKKSKRHQAQGCTDESICDNMDINGEGHDVICHCA
SSSHCTSDPALLVLDVFLSCHPTKIARCENFPSVMRAFSDLLDQLRGVSPEIELHVKKEA
FVFASDWYSTLIGSQVNPTEVVAFLQLLAIYKITDSFHPDGLLGLLEKVQPTEKVVALVK
ILGLTDEIQCMSLSSIVCFTLKCAHVHSKSPPNMNDMLHCLWSYGVTNFILCIL
Download sequence
Identical sequences M1C1V6
PGSC0003DMP400038984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]