SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400040751 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400040751
Domain Number 1 Region: 136-250
Classification Level Classification E-value
Superfamily Translation proteins 1.52e-37
Family Elongation factors 0.0000432
Further Details:      
 
Domain Number 2 Region: 251-348
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.44e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00042
Further Details:      
 
Domain Number 3 Region: 16-134
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-27
Family G proteins 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400040751
Sequence length 360
Comment PGSC0003DMT400060510
Sequence
MCDVPGFENCKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQTSE
HLAAVEIMRLQHIIILQNKVDLVQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNI
DVVCEYIVKKIPIPERNFTSPPNMIVIRSFDVNKPGFEVDDIRGGVAGGSILKGVLKVNQ
LIEIRPGIVVKDESGNIKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADR
LVGQVLGEVGSLPEVYVELEVNFFLLRRLLGVRTKESERQGRVSKLAKGEILMLNIGSMS
TGARVVAIKNVFAKLQLTSPVCTSKGEKIALSRRIEKHWRLIGWGEIQAGITLDVPSSPL
Download sequence
Identical sequences M1C611
PGSC0003DMP400040751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]