SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400044805 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400044805
Domain Number 1 Region: 66-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000216
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 2 Region: 256-287
Classification Level Classification E-value
Superfamily PetM subunit of the cytochrome b6f complex 0.00000000392
Family PetM subunit of the cytochrome b6f complex 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400044805
Sequence length 290
Comment PGSC0003DMT400066469
Sequence
MEEEDEEEEEEDYDDDDDEEEEETEEDEETEEDERTVGGKRDTACKVRDVPDQYGADIFK
SGRATQPKNLYFVAKIRVKRRDQLYIPIDVVRDYKLELPSRMIIRDSAGREFETKLKNWK
DGRIWLAGGWRSLCRWNLVEKDDRCICEFMRGKGKRGLYLQVGGQKTMATMTTFSAATVS
SAAIIGTGRNSSQKGTKVKYISGLNSFEGLKANNHVASLGLPMSTEQAFAKIVSSLKTPS
SQANGGALSSTCNAALEIFRIATIIPGLVLVGVAVGFVLLRIEATVEESE
Download sequence
Identical sequences M1CFK6
PGSC0003DMP400044805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]