SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400044806 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400044806
Domain Number 1 Region: 269-368
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000106
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 2 Region: 81-175
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000765
Family B3 DNA binding domain 0.0056
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400044806
Domain Number - Region: 158-227
Classification Level Classification E-value
Superfamily ARM repeat 0.0101
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400044806
Sequence length 375
Comment PGSC0003DMT400066470
Sequence
MGKNFVKIGKAPRSKHRHAEETEEEEYEDEEEEEEQNEWAGIVEKNASCSKAGYQRATAR
KVRDSHDQFGADIFKSGHATRPRNPYFIAKLQAKRRDQLYVPIDVIKGFNFELPSSITIR
DSTGREFETKLKNWKDGRIWLIGGWHSLCRWNLVEKDVKCICEFVKGKGNKVLYLQVQIL
HEGSVSNSNTKHMEEEDEEEEEEDYDDDDDEEEEETEEDEETEEDERTGTFKKNVSHSKV
GGKRDTACKVRDVPDQYGADIFKSGRATQPKNLYFVAKIRVKRRDQLYIPIDVVRDYKLE
LPSRMIIRDSAGREFETKLKNWKDGRIWLAGGWRSLCRWNLVEKDDRCICEFMRGKGKRG
LYLQVHVLHEGSVSE
Download sequence
Identical sequences M1CFK7
PGSC0003DMP400044806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]