SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400065046 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400065046
Domain Number 1 Region: 40-75
Classification Level Classification E-value
Superfamily Translation proteins 0.00000415
Family Ribosomal protein L3 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400065046
Sequence length 83
Comment PGSC0003DMT400093371
Sequence
MYAQVSLPLVISRDKGSLADQQWLSSAGHVQSVGSDRDRAPLKVACIGAWQPARVSLTMV
CVGQNGYHHRTEQHLLHWEKHKF
Download sequence
Identical sequences M1DRU0
PGSC0003DMP400065046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]