SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390936336|ref|YP_006393895.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390936336|ref|YP_006393895.1|
Domain Number 1 Region: 27-394
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-100
Family AAT-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390936336|ref|YP_006393895.1|
Sequence length 397
Comment aspartate amino transferase [Bifidobacterium bifidum BGN4]
Sequence
MSETKQPTMSRRAREAQPFRAMVFGERADEMIARSISVIKLSLGEPDFGAPPAVRDAMRE
QYDGRALPYTAALGLPELRRAIADFYHERHHVDIDPRRIVITAGGSAALLLATALTVDPG
DEVIVADPSYPCNRELIRSFEGVVVDVPTSAATRFHLNAELVDRAWSERTKAVMVTSPSN
PTGTTIDFDVLKGVCDLARFRGAWRIIDETYLDLADREPDGSEVRSALLADPDAIICNSF
SKFFGMTGWRLGWAVVPEYTIEAVDDLATNYYLCAHTPTQHAALACFTPESLAVCEERRQ
ELLARRRIVVSGLERIGLPLEVVPNGAFYAYFSVAGTGLDAWTFCERALEEAHVALTPGR
DFGPATADTHVRLSYAASREALTEGLSRLGKFVASLR
Download sequence
Identical sequences I3WGK3
WP_014759933.1.10423 WP_014759933.1.12576 WP_014759933.1.15820 WP_014759933.1.20455 WP_014759933.1.37813 WP_014759933.1.37909 WP_014759933.1.44067 WP_014759933.1.44436 WP_014759933.1.53194 WP_014759933.1.54468 WP_014759933.1.56383 WP_014759933.1.57531 WP_014759933.1.61429 WP_014759933.1.70584 WP_014759933.1.73194 WP_014759933.1.76317 WP_014759933.1.80288 WP_014759933.1.84193 WP_014759933.1.93614 WP_014759933.1.97298 gi|390936336|ref|YP_006393895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]