SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390936500|ref|YP_006394059.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390936500|ref|YP_006394059.1|
Domain Number 1 Region: 14-98,130-420
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.76e-92
Family Cystathionine synthase-like 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390936500|ref|YP_006394059.1|
Sequence length 425
Comment putative cysteine desulfurase [Bifidobacterium bifidum BGN4]
Sequence
MADTPNASGEPDELYLDAAATEPVTRNVIEAMMPFMTDAYANPASVHQPGKTAARALDAA
RASFAAGLGARPDDVIFTSGGTESDNLAIKGIAMARMRALGLQPVYGLAGIDDEPSGVNP
AQAGEHPAIRRPRIIISSIEHPAVAQSAQWLHEWFGFEVVHIPVDGQAHLDLDALEQELD
GEAGERTTLVSAILANNEVGTVEPVEELVRIAHAHGVPIHVDAVQAAGQIPIRMRDWDVD
ALSVSGHKFGTPKGLGALLVRGRTPIEPVLSGGGQERGLRSGTQNVAGAVALAIGLNESN
ARMAAQYRELTDSRDMLIDAVRRVVPRAELTGDPVSRLPGHASFIFPGVTGEALLVDLDA
RGIAASSGSACAIGRHEIPGTLLAMGLEPQIAKSALRMTFRRPLTREEIERISMALEDSY
TELTH
Download sequence
Identical sequences A0A0H2PIR9 I3WH17
gi|390936500|ref|YP_006394059.1| WP_014760034.1.15820 WP_014760034.1.61429 WP_014760034.1.76317 WP_014760034.1.84193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]