SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390936577|ref|YP_006394136.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390936577|ref|YP_006394136.1|
Domain Number 1 Region: 1-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-53
Family AAT-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390936577|ref|YP_006394136.1|
Sequence length 396
Comment putative amino transferase [Bifidobacterium bifidum BGN4]
Sequence
MRFSSRVDLSEPNPIAAAETHCRCEGMPLGKLNDSNPTRHGLAPALVPGTYTADPRGPRP
AREALASFLTELHRGAEGAGTAPAADPNRLYLLSSTSQAYSWLMKLLCDAGDAVLAPKPG
YPLIESIARLECVDTIEYQLRFDGSWYIDVAELRALLDGPQGARIRALVLINPNNPTGSY
VKAGEREQLVGLCRERGVAIIADEVFYDYALEPFPGNARLAGEAGALTFALDGFSKMLAA
PHAKVGWIQVSGPETDVREAMRRLDVIADDYLPMSDIIASRIPDLLEAAKVQTDLVRGRV
QGNLRALHRMLESDPLGVVSVLRAEGGWNVLLRVPGVIDENELVLHMIDAHGVSGQPGYF
FDMASNGYLAISLLPEPDEFAHNVRVVLDSVAELLG
Download sequence
Identical sequences A0A0H3EC25 E4V8W0 I3WH94
WP_003812582.1.12576 WP_003812582.1.20455 WP_003812582.1.36960 WP_003812582.1.37909 WP_003812582.1.56383 WP_003812582.1.61429 WP_003812582.1.7567 WP_003812582.1.81148 YP_003970807.1.28674 gi|390936577|ref|YP_006394136.1| gi|311064082|ref|YP_003970807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]