SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390936732|ref|YP_006394291.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390936732|ref|YP_006394291.1|
Domain Number 1 Region: 3-417
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.28e-109
Family Cystathionine synthase-like 0.0000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390936732|ref|YP_006394291.1|
Sequence length 423
Comment putative cysteine desulfurase [Bifidobacterium bifidum BGN4]
Sequence
MVDFTAIRAQFPILDQQIHGHPLVYLDSAATSQKPQCVIDAESEFYRTINAGVHRGAHEL
AARSTMAFEDARAKVARLVGANAEEGNEEIVVTAGATAGLNLLATAFGNASLGRGGEAAK
RFALKPGDEIVVSKAEHHSVLLPFQELAYRTGATLKWFDLTEDGRIRSDTADEVITEHTK
VVAITHVGNTTGAITDIAPIIRRAHEVGAIFILDACQSVPHLKVDFHALDVDFAAWSAHK
MYGPTGVGFLYGRRELLEALPPANFGGSMVELAWMDQPAQYMVPPARFEAGTQPVAQVVA
AGVAAEWMMNVGLENIEAHERTIAAELLKIGDIDGVRILGPRENVNRIGTVAFDVAGVHP
HDVGQFIDAQGIAIRVGHHCAQPVHRHFGLYASNRASSGVYNSVDDAHALVEAVAKVRPF
FGL
Download sequence
Identical sequences A0A0M3T7G4 I3WHP9
gi|390936732|ref|YP_006394291.1| WP_014760155.1.10423 WP_014760155.1.61429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]