SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390936998|ref|YP_006394557.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390936998|ref|YP_006394557.1|
Domain Number 1 Region: 22-422
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.61e-112
Family GABA-aminotransferase-like 0.000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390936998|ref|YP_006394557.1|
Sequence length 429
Comment acetylornithine amino transferase [Bifidobacterium bifidum BGN4]
Sequence
MPTKETLGPTDSQWLGQYSQVHMNVFGTPLRVMDHGEGVRVWDVDGNEYLDFLAGIAVNS
LGYAHPAWVKAVSEQAAKCAHVSNYFATEPQIRLASRLIELAGAPEGSHVYFGNSGAEGN
EAALKLAKLYGRTLPGASPSIGGKPARILALTHGFHGRTMGALSATWKPVIRKPFEPLVP
NIEFVRAGDPIAMYEAFSATGLGQYGKGPVAAVILELIQGEAGVRPLDVAYVKKVREMCD
INHALLIIDEVQTGIGRTGSWFAFQREDLTGGITPDIVTFAKGVAGGFPMGGMISFGGKL
SALFTPGSHGSTFAGNPLGAAAALATLDTIENEHLVENAEERGEQLRQGVMASGNPLFTS
VRGRGLLNAILLSHRCSHAAMNWALEHGLIVNAVAPDALRLAPPLIVSEQEIDEAVSILA
KIPADLPND
Download sequence
Identical sequences I3WIG5
gi|390936998|ref|YP_006394557.1| WP_014760331.1.61429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]