SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390937061|ref|YP_006394620.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937061|ref|YP_006394620.1|
Domain Number 1 Region: 8-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.04e-116
Family Cystathionine synthase-like 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390937061|ref|YP_006394620.1|
Sequence length 438
Comment O-acetylhomoserine (thiol)-lyase [Bifidobacterium bifidum BGN4]
Sequence
MTEANKKYRFETLQLHVGQEQADPATDSRAVPIYATTSYVFHNFDHAEARFGLADPGNIY
GRLTNSTQGVFEDRIAALEGGTAGIAVASGAAAVEYAVRNITQSGDHIVSSKNIYGGTFN
LLKHTLPRDGITTTFVDPEVPQNFEDAIQENTKLVYFETFGNPNADLPDFEAISAIAHKH
HLPVIVDNTFATPYLFRPLEHGADVVVESATKFIGGHGTTLGGVVVEGGNFNWAEVPGKF
PTLTEPDPSYHGLNFYEALGGAAFVTRIRAILLRDTGATLSPFAAFLLLQGTETLSLRVE
RHVQNALKVVEYLQTVPEVESVSHPSIEGRRDHELYKKYFPNGAGSIFTFDIKGGKDAAR
VFIDNLHLFSLLANVADVKSLVIHPASTTHSQETLEELEDQGIHQGTIRLSIGTENIEDI
LDDLKGGFEALRASGLAK
Download sequence
Identical sequences A0A0E2Z9M9 A0A0H3EDB8 E3EMD3 I3WIM8
gi|310287685|ref|YP_003938943.1| gi|311064582|ref|YP_003971307.1| gi|390937061|ref|YP_006394620.1| WP_013363634.1.10423 WP_013363634.1.2471 WP_013363634.1.26466 WP_013363634.1.36960 WP_013363634.1.37813 WP_013363634.1.44436 WP_013363634.1.53194 WP_013363634.1.54468 WP_013363634.1.56383 WP_013363634.1.57531 WP_013363634.1.61429 WP_013363634.1.7567 WP_013363634.1.76317 WP_013363634.1.80288 WP_013363634.1.81148 WP_013363634.1.97298 YP_003971307.1.28674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]