SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390937190|ref|YP_006394749.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937190|ref|YP_006394749.1|
Domain Number 1 Region: 1-341
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.53e-78
Family AAT-like 0.00000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390937190|ref|YP_006394749.1|
Sequence length 341
Comment low specificity L-threonine aldolase [Bifidobacterium bifidum BGN4]
Sequence
MLSFGNDYSYGACPEILDRLARTNDTAFPGYGSDAACEDAKRRIREACETPDADVWFLVG
GTQTNQTVIDTMLAPYEGVVTVDSGHPNVHEAGAIESTGHKVITLPHHAGKLDAAELDDY
CATFYADDNHEHMVFPGLVYISHPTEYGTIYGKAELEAIAETAHRHGMPLFVDGARLGYG
LTAAGTDVTLPDLARIADVFYIGGTKVGALFGEAVVFTKGNTPKHFLTQIKQHGALLAKG
WLLGLQFGTLFTDDLYLRIAANANRQADRIREALRERGYTLTFEAPTNQVFVTLDHPTIE
RLQAHVRMGFMEKADNEHTVMRLCTSWATTDEQVDQLIALL
Download sequence
Identical sequences A0A0H2NHN0 I3WJ07 R6GKN4
WP_014760469.1.10423 WP_014760469.1.2471 WP_014760469.1.44067 WP_014760469.1.44436 WP_014760469.1.56383 WP_014760469.1.61429 WP_014760469.1.73194 WP_014760469.1.7567 WP_014760469.1.76317 WP_014760469.1.7788 WP_014760469.1.81148 gi|390937190|ref|YP_006394749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]