SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390937308|ref|YP_006394867.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937308|ref|YP_006394867.1|
Domain Number 1 Region: 3-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.53e-107
Family Cystathionine synthase-like 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390937308|ref|YP_006394867.1|
Sequence length 425
Comment O-acetylhomoserine (thiol)-lyase [Bifidobacterium bifidum BGN4]
Sequence
MTHIDTTCVQGGYQPGNGESRTPPIIQATTFKYTSSEQMSRLFDLSESGYFYTRLQNPTN
DTVAAKICELEGGAAAMLTSSGQAANFFALFNICNAGDHIVASSAIYGGTFNLINVTMRK
MGIECTFVSPDCTPEELDAAFRPNTKAVFGESISNPALIVLDFDKFTAAAHDHGVPIIVD
NTFPTPVNCRPFDYGVDIVTHATTKYMDGHGSCVGGAIVDSGRFDWMAHADKFPGLTTPD
DSYHGVTYATDFGPAAYIIKATAQLMRDFGSTPAPINSWIMGMHLESLAVRMERHCANAL
AVARFLEADPRISWVSYPGLEGDRNHALAAKYMPNGTCGVISFGVPGGRDTVSSLLDHFR
MISIATHVADARSCTLYPAGTTHRQLTEEQLEEAGVGIDLVRLSCGIENADDIIADLRQA
MDAVL
Download sequence
Identical sequences A0A0E2ZEU6 A0A1Q6EUK9 E3EQB5 E4VC16 I3WJC5 K2I7M9 K2MC58 U2DU79
gi|310287887|ref|YP_003939145.1| gi|390937308|ref|YP_006394867.1| WP_003814823.1.10423 WP_003814823.1.12576 WP_003814823.1.15820 WP_003814823.1.20455 WP_003814823.1.26466 WP_003814823.1.37813 WP_003814823.1.44067 WP_003814823.1.44436 WP_003814823.1.53194 WP_003814823.1.54468 WP_003814823.1.55739 WP_003814823.1.56383 WP_003814823.1.61429 WP_003814823.1.70584 WP_003814823.1.73194 WP_003814823.1.7567 WP_003814823.1.76317 WP_003814823.1.7788 WP_003814823.1.80288 WP_003814823.1.81148 WP_003814823.1.84149 WP_003814823.1.84193 WP_003814823.1.97298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]