SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390937576|ref|YP_006395136.1| from Bifidobacterium bifidum BGN4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937576|ref|YP_006395136.1|
Domain Number 1 Region: 13-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-108
Family AAT-like 0.00000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390937576|ref|YP_006395136.1|
Sequence length 409
Comment aspartate amino transferase [Bifidobacterium bifidum BGN4]
Sequence
MSMPALSQHSLSVPRSGIRDVFDRVEHVPDAISLCVGEPSATAAPHIVEAACRSIREGHT
TYTNVLGIEPFREAVAAYSEKVKGLRYDVDTEIQAVDGATIGLFLAMKALLDAGDEVILP
SPYFTSYDAEALMCGGVPVPVALKPEHQMRLNADDIEAAITPRTKAVLLNSPGNPSGAVT
PLSELERIADVCIRHDIWVISDEVYHPFVFDGSASIAPSIAAIDGMHERTVVVESLSKTF
AMTGWRIGYLLGPEPLIEQTSKLAELMHSSVNSTAQYAAVAALTGPQEHVTAMREEYCAK
RQIVLDELDGCTALRLIEPQGAFYAFVDVRACGMDCDRFSRMLLDEEHVAVVPGTAFGSE
GAGFVRLSYAGDGRELREGVRRMRVFAERHVNPALGRHTPGYHHLQIMA
Download sequence
Identical sequences A0A0M3T7Y1 I3WK44 U2DSV8
WP_014760684.1.10423 WP_014760684.1.12576 WP_014760684.1.20455 WP_014760684.1.37813 WP_014760684.1.53194 WP_014760684.1.56383 WP_014760684.1.61429 WP_014760684.1.7567 WP_014760684.1.7788 WP_014760684.1.81148 WP_014760684.1.97298 gi|390937576|ref|YP_006395136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]