SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384197245|ref|YP_005582989.1| from Bifidobacterium breve ACS-071-V-Sch8b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384197245|ref|YP_005582989.1|
Domain Number 1 Region: 330-451
Classification Level Classification E-value
Superfamily TPR-like 0.0000198
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384197245|ref|YP_005582989.1|
Sequence length 615
Comment hypothetical protein HMPREF9228_1160 [Bifidobacterium breve ACS-071-V-Sch8b]
Sequence
MAEGNERSGKSYGGGHKGYGDRRPGNRGGKGFKPRGKGGFKPRHDGEGFKPRRREDGEGH
APRRDGDGEGRGGYRKSYGKGGDFHKGGRSGYRGNGPRRDGEGFRPRRDHDGEGFKPRRR
EDGEGYAPRRDGDGEGRGGYRKSYGKSGGFHKGGYRGNGPRRDGDGFKPRREGGYRSHEG
ENGENPRYQHRDNDRRDFRRDGDRRDFHRDGDRRDFHRDDRRNDRRDFHRDGDRRNFRRD
DRRDNDRRDGYREFSQEEKRQYREEKRSEYMNRPRRNSDGTMSFPSQNPYTDRRPDEPKM
PKGMEWSMLSSDERERLRGLSKEHAENIGLHILAAFAQEEDDPQNALEHAKWVARQASRI
DFARETLAFIAYRQGDYKLALREFRTAYRMNGFQDYLPFIADCERGLGNPKKAVELALSD
EGKALHGSPKVEMFLVYAGALGDLEMWDKAIDVVHAVGRSQGLPGEYRMRAVQAEQYFLE
EAGRNKEAEQLNDLLDRLEDQYADEDIDEDSDDVVIDHDLEDITDDSEVMETLGIDPSEA
QYAPELEPEESEEPESEEPEESEDAEEPEDDEAAEESDVAESDATEESEESDEPAESEES
ADDAPAEAESEETEE
Download sequence
Identical sequences WP_014483926.1.45026 WP_014483926.1.51746 WP_014483926.1.81684 gi|384197245|ref|YP_005582989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]