SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384197278|ref|YP_005583022.1| from Bifidobacterium breve ACS-071-V-Sch8b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384197278|ref|YP_005583022.1|
Domain Number 1 Region: 895-1001
Classification Level Classification E-value
Superfamily TPR-like 0.00000000137
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384197278|ref|YP_005583022.1|
Sequence length 1100
Comment hypothetical protein HMPREF9228_1199 [Bifidobacterium breve ACS-071-V-Sch8b]
Sequence
MNALASDLGLSKPRQASTNPFGDALSEASERKGGIIDELTKHAVSLSPVVKRRSFPALEN
VPEGLVLGWAQLPSTRGRGFSLGIFPDRDHFAQVAFADTHGRVFVGADLDMDIQDMQPRF
MFGKEKEVTLPNGERLGFDAGQTRRNVLGRAIRSNGEVKAITGGVIGRDDTGRMTWLASW
LKAGNRYTLEQMRANLPADMRHDLEYRDAVAIAFFAAYMLPQINGLLIGFGSGNIFRRLN
REAPIGAIRRSIRDTMEARAHGMRASGLEDHFADLMREAGALDNTPGLEAVHGAEPLHLY
TSTYSSGYFFTWDKSLAFNQALKSLKIEGNLNRFAAVSAWLERNSSRGLNPTEDTVTRAE
AAQIDMKLIENPAIMALNPYDGSDERRAVLSLVNAAEHAADRIREEFPDPRNAAPKADEW
VYRQTLSSLLRRLRLPYRFDVEFRSRLDSGEVAIGFTTAGTSMMPDSRYDTERRTWRTLS
SVERASMSASYNLRVGLMMAALSFGTSQAVHQVSLHIDSIGLEEAIAEQDSAIEEMMSEA
LSAFEHLRSGDLGRVSSKADPKDGDFHGDPTRPITHEETFGQPPTGTGDEQPATDAETDG
ADPSQQNAEDSDDSASIDSQFEDLMRGIDIDEMAFGMASDDGNETENAGAGDDPMSVLRR
NPTVRNMVTVTFARDAFLQRLDTDGLDHPEETYRMFGAVMDVDGEGGLKPINADFDLADS
RFSPVGSQEEPELADRQFNASTARVLGAQNSAGLAIQRVDLLQHGVNAFHDIARNTELDS
VEKAQRAMQIIESISDPELTGLASQVTSALIDGNDTPDFAFTLADELDKERLRARDLLFS
GQADQAIEMAEAAAARMDQTFAMGSGVPRYFNSYAERVVYNRLFATLDERTVLIPDNLFY
AHMELADVLGQLKGAKAAIPHLNRMVAYAPAYPLSHLKLAIQLARNEDWDSARAACLNAL
RVALDRDDAAFAYYRFAYAEWMLDRFDTAAAAYIMSDHIAPGAIGSLESELQELVSRADS
QCIRVPESVESAAQVLSSHDLPVWPHIEVADIVRDAARVCVDEGMFVPARTLSVAVARMN
DGEGDNIDVIQAQFLRSLSA
Download sequence
Identical sequences WP_014483944.1.45026 gi|384197278|ref|YP_005583022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]