SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406597816|ref|YP_006748946.1| from Alteromonas macleodii ATCC 27126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406597816|ref|YP_006748946.1|
Domain Number 1 Region: 20-383
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.86e-108
Family FMN-linked oxidoreductases 0.00000000489
Further Details:      
 
Domain Number 2 Region: 394-626
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.96e-41
Family C-terminal domain of adrenodoxin reductase-like 0.00018
Further Details:      
 
Weak hits

Sequence:  gi|406597816|ref|YP_006748946.1|
Domain Number - Region: 601-676
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0285
Family C-terminal domain of adrenodoxin reductase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|406597816|ref|YP_006748946.1|
Sequence length 692
Comment 2,4-dienoyl-CoA reductase [Alteromonas macleodii ATCC 27126]
Sequence
MNTPSSQTATPQSAHNSEQLSPYFPNLLSPLDLGFTQLRNRTLMGSMHLGLEEEKGGFDK
LAAFYAERAKGGAGLIVTGGISPNISGWVAPFAGRMTRSRHAKKHRVITDAVHKEDGKIC
MQILHSGRYGYHPLAVSASPMKSPITPFKPRELSSRGVRSTIKDYVKCAALAQQAGYDGV
EIMGSEGYLINQFFCERTNHRNDEWGGSLENRARLAIEIVKGVREKVGTNFIIIYRLSML
DLVEGGAKWDEVVYLAKEIEKAGATLINTGIGWHEARVPTISTSVPRAAFTWITERMKKE
VSIPLITTNRINTPEVAESVLAQGHADMVSMARPFLADAHFVAKAMRNESKLINTCIACN
QACLDHAFEQKRASCLVNPQACYETELTFPPTHNKKRLAVVGAGPAGLAFSMYAAERGHE
VHLFDKASEIGGQFNYAKQVPGKEEFYETLRYFDNQLARLGVTVHLNTEINAERLADEKF
DEVVLATGINPRTLKIEGHDHPKVMSYLDVLRDHKPVGKKVAIVGAGGIGFDVAEFLVEH
EHLAKDKEKWLAHWGIDKDYAAPGALKEKAIEPSDREVYLLQRKTSKVGKGLGKTTGWIH
RQSLKHHNVQMINGVSYEKVDDEGLHVLINDTPKVLPVDNVIVCAGQEPFKPLQQPLEEA
GFTVHIIGGADVAAELDAKRAIRQGAELAARI
Download sequence
Identical sequences gi|406597816|ref|YP_006748946.1| WP_014950469.1.49223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]