SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14521877|ref|NP_127353.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521877|ref|NP_127353.1|
Domain Number 1 Region: 146-361
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0016
Further Details:      
 
Domain Number 2 Region: 537-739
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.57e-34
Family Multidrug efflux transporter AcrB transmembrane domain 0.018
Further Details:      
 
Domain Number 3 Region: 470-569
Classification Level Classification E-value
Superfamily Globin-like 0.0000815
Family Truncated hemoglobin 0.063
Further Details:      
 
Weak hits

Sequence:  gi|14521877|ref|NP_127353.1|
Domain Number - Region: 60-115
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0146
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14521877|ref|NP_127353.1|
Sequence length 746
Comment transport protein [Pyrococcus abyssi GE5]
Sequence
MLRKIARVIVIYRHSLAVVTMFLLILSAYGITQLRFETDLSKQLPEDLEAVKSYFTLQNE
FGGSGSALIYVKIKNNDNVVDIRDPKIIEAMYSLEQRLREKEYVTDTFSIADLMVQILGR
LPKNMDEVKFVLNMLPPEARNGLISGDYSSTIIIVNLNREKNQKALVRVYNDIEREIERT
NFPQGVEVVLTGDLGITYKILEMLQNDMNRTMAISGIIVVLILLYFYKSPIRMLVPLVPL
IFGVVMTLGFMGLLGIPLDIATTTVGAMIIGMGIDYGVHVTNRYYEERGKGKSLEEAAEE
AIAETGKALLGAALTTIAGFLALSISILPSLKRLSVSLVMGLGLAALNAVIVTPALAILE
EEFREKVMKKKEIIAIGGGKSKISFIFSMLGKAIKRSPWTALLIALIISGVSLYGASKIT
TEVRLEKMIPTDLPEIQALSDIRSEFGGQDEVTILIKADDVRDPTLVRDILRFEREIKAD
SYINNVFETQSIADVVIQKYGYIPQDKEKISEAIEGSSLVSSDYSMTIIKLKGNFMGVTQ
SEFNRIMEYFERAIQRADFPPGVKVELAGESYLNYVLNDLVNEELGKISTIGTLIVVMVV
FAIFRRPTVSIAMIMPMFLGALWTIGYMGLAGIPFSQTLAGVVSMIVGLGVDYGMHITHR
FLEELNEGNKTPIITALESVGPGIFVGALTTAGGFLALLSAQLTAIHDFGRVLAVGIFAS
MFAAYLVTPAILQLEFGRKISKEVRE
Download sequence
Identical sequences Q9UY29
272844.PAB1101 WP_010868797.1.84333 gi|14521877|ref|NP_127353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]