SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14521911|ref|NP_127388.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521911|ref|NP_127388.1|
Domain Number 1 Region: 2-211
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.12e-45
Family Decarboxylase 0.0045
Further Details:      
 
Domain Number 2 Region: 215-404
Classification Level Classification E-value
Superfamily SIS domain 3.34e-41
Family mono-SIS domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14521911|ref|NP_127388.1|
Sequence length 406
Comment D-arabino 3-hexulose 6-phosphate formaldehyde lyase [Pyrococcus abyssi GE5]
Sequence
MILQVALDLTDIEQAISIAEKAARGGAHWLEVGTPLIKKEGMRAVELLKRRFPDRKIVAD
LKTMDTGALEVEMAARHGADVVSILGVADDKTIKDALAVARKYGIKVMVDLIGVKDKVQR
AKELEQMGVHYILVHTGIDEQAQGKSPLEDLEKVVKAVKVPVAVAGGLNLETIPKVIELG
ATIIIVGSAITKAKDPEAVTRKIIDLFWDEYMRTIRKAMKDITEHIEEVADKLKLEEVRG
LVDAMIGANKIFIYGAGRSGLVGKAFAMRLMHLDFNVYVVGETITPAFEEGDLLIAISGS
GETRTIVDAAEIAKQQGGKVVAITSYRDSTLGKLADVVVEIPGRTKADLPTDYIARQMLT
KYKWTAPMGTLFEDSTMIFLDGIIALLMATFQKTEKDMRKKHATLE
Download sequence
Identical sequences Q9UXZ5
gi|14521911|ref|NP_127388.1| 272844.PAB1222 WP_010868830.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]