SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14520368|ref|NP_125843.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14520368|ref|NP_125843.1|
Domain Number 1 Region: 33-338
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.02e-51
Family Phosphate binding protein-like 0.000000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14520368|ref|NP_125843.1|
Sequence length 344
Comment molybdate ABC transporter periplasmic substrate-binding protein [Pyrococcus abyssi GE5]
Sequence
MRLGLKIASLAIVFLILGCLGGGETETGQKTAKLIIFHAGSLSVPFSQLESEFAKYAEKE
LGIKVTFQDEASGSVKAVRKVTDLGKKADIVAVADYTLIPQLMVPNYTDFYVLFATNEIV
IAFTEKSKYADEMLKNPDKWYEILAREDVSFGFSDPNQDPCGYRSVMVMKLADLYYGKPI
FETLVEKTTNIYANGTHIYAPKEIIVKDKRVVIRPKETDLVGLVESGSLDYFFIYKSVAE
QHNLKYITLPNEINLKDFSKADFYKKVSITLGSTGKTIYAKPIVYGITVLKDAPNRELAL
EFLKFLLSEKGKEIFRENHQDFLTPPVAFGNVPEEIKGLVEIKE
Download sequence
Identical sequences Q9V2C4
272844.PAB0101 gi|14520368|ref|NP_125843.1| WP_010867274.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]