SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14521761|ref|NP_127237.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521761|ref|NP_127237.1|
Domain Number 1 Region: 73-141
Classification Level Classification E-value
Superfamily NfeD domain-like 3.14e-23
Family NfeD domain-like 0.000047
Further Details:      
 
Weak hits

Sequence:  gi|14521761|ref|NP_127237.1|
Domain Number - Region: 11-96
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0628
Family ABC transporter transmembrane region 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14521761|ref|NP_127237.1|
Sequence length 147
Comment hypothetical protein PAB1325 [Pyrococcus abyssi GE5]
Sequence
MMTMDALPISLLILGLLIIILDMMVSAFITPIGIAFSVLGLLLLFKVNFYLSFVISLISA
VLSYMAFARMIKRETRDIGREKYTFELKGKTGKVVKVSEDHYLVEVEGDRWIAYSDEELK
VGDTIVVEDVDGVKLKVRKAPRSRSPQ
Download sequence
Identical sequences Q9UYE5
gi|14521761|ref|NP_127237.1| 272844.PAB1325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]