SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18311898|ref|NP_558565.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18311898|ref|NP_558565.1|
Domain Number 1 Region: 186-329
Classification Level Classification E-value
Superfamily YutG-like 4.05e-28
Family YutG-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18311898|ref|NP_558565.1|
Sequence length 331
Comment hypothetical protein PAE0371 [Pyrobaculum aerophilum str. IM2]
Sequence
MLIEERKGLVLAKLGNRYKVLSTVPSPDYAEAVAFVQVPKDYCGDFLQDASKVRDDLGLE
AVVFFTAAELPDSFVSLSEGDVKVAATVAMTPQTCIGTINVAVVVNRPLSKWGMADLLRT
ATEAKALAAVDSLLRCNGRRSPGTVTDAVAILAQEGDGEHYAGPATELGQTAARLVYKAV
RAGDRYDLFQRIFGLSRREFAGLVKRLFEKAPLPAGEEEILSALEELLKDPNVWALLIAA
AELDAHATSGGIPGLAPDEHSADTPRIIIDELLGAALADYIGGFKAVLTTYWVERVKKDG
GIPELEMFRDDVLSALLAGVYLRLYERIYGR
Download sequence
Identical sequences Q8ZZ94
gi|18311898|ref|NP_558565.1| 178306.PAE0371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]