SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18312608|ref|NP_559275.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18312608|ref|NP_559275.1|
Domain Number 1 Region: 74-464
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.41e-69
Family L-arabinose binding protein-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18312608|ref|NP_559275.1|
Sequence length 472
Comment branched-chain amino acid binding protein [Pyrobaculum aerophilum str. IM2]
Sequence
MANAKTLWIVAAVVATIIVGALAWLATQTPAQTPTTPPTTPSPTPTTPKVTTTPPTTTPT
PTPTTTQAGECPDEIVIGTAMPISGRYAAEGQYSLWGALAVVNWINDQGGLDCGGKKVKV
RLIYRDSESKLELAQSITEALITQDKVHFLLSPYGSDLALGVSPIAEKYGVIMAVVGASS
DRIFQQGFMYVIGVAAPASQYMVPVLDMIVKKDPSVKKVAILYRDSEFNRQVAEGAKAYA
EKLGLQVAVYEVYPSSPKDLTPQILKVKQAAPDVIIVASHFADGQLAVQQLAEQKVDAKI
IALSVAPLVPDFYNALKEKAECIVGPSHWEPGVKYTPDLAKQRGVEWFGPTREEFIQYFK
KVAKQMGGQEVEPGYHAAWAAEGVLTILYGVQKAMSVKSDKVLSVLQKARFMTFFSEFKL
DPTTNLNVAHSMAVIQWQDGSRVVVWPPDVAEGKLVYPALTWDQKASGQRCK
Download sequence
Identical sequences Q8ZX92
gi|18312608|ref|NP_559275.1| 178306.PAE1392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]