SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18312622|ref|NP_559289.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18312622|ref|NP_559289.1|
Domain Number 1 Region: 14-99
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000111
Family Apolipoprotein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18312622|ref|NP_559289.1|
Sequence length 129
Comment hypothetical protein PAE1418 [Pyrobaculum aerophilum str. IM2]
Sequence
MLSEPPQLIRDKKVEKDDLMLILNYALLERLKSLDDGVKSLEKELGKRFKSLEREISALR
SDVREMHKDLKEMRRELSEKIENMHKDMRERLDLINNQLRVLNANIASTYELTSKVVAML
MAKGTPLPS
Download sequence
Identical sequences Q8ZX78
gi|18312622|ref|NP_559289.1| 178306.PAE1418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]