SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18312963|ref|NP_559630.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18312963|ref|NP_559630.1|
Domain Number 1 Region: 1-353
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 4.06e-121
Family Chorismate synthase, AroC 0.000000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18312963|ref|NP_559630.1|
Sequence length 368
Comment chorismate synthase [Pyrobaculum aerophilum str. IM2]
Sequence
MNTFGREFRITTFGESHGKAVGVVIDGVPAGLPLSEEDIKRELERRMFCHIHWLNPRCEP
EEFEILSGVKNGHTQGTPIAIVIWNKRAISSYYDELWMKPRPGHADLAYYLKYGKFYDHR
GGGRASGRTTAAIVAAGAVAKKLLSQLGVDVCGHIIELGGIEVRRSYTFEEVKSSWAKPL
PVVDDEALAAMLETLRKNAAEGDSVGGGVEIWAVGVPPGLGEPHFGKIKAELAMAAFSIP
AVVALDWGAGRALAKMRGSEANDPIIIKSGRPALESNKIGGVLGGITVGEPIYFRVWFKP
TPSVRKPQRTVDLAKMEPAVLEFKGRYDVSVVPKALVALEAMTAITLADHALRAGLVRRD
RPLRDPVV
Download sequence
Identical sequences Q8ZW90
gi|18312963|ref|NP_559630.1| 178306.PAE1912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]