SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18313106|ref|NP_559773.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18313106|ref|NP_559773.1|
Domain Number 1 Region: 167-288
Classification Level Classification E-value
Superfamily DNA primase core 0.0000000000262
Family DNA primase DnaG catalytic core 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18313106|ref|NP_559773.1|
Sequence length 408
Comment DNA primase [Pyrobaculum aerophilum str. IM2]
Sequence
MGALTIVAKYMIVAQIEVNGSVDKSDIIGALFSQTEGLLGKDMDLRELQMMGRIGRIEVD
IFEKNGKTKAKIHIPSNLDRYETALVAALIESIERVGPYPAAVKVVEIRDLREEKRKKII
EKAKELVKLIEEEILPDTKEIIEKLKEDVAKAEIIEYGPERLPAGPDVDKSDSIIIVEGR
ADVVNLVKHGYRNVIALEGISRGVPQTIIELSKKKNVTVFIDGDKGGELVLRELLKVAHV
DYIARAPPGKEVEQLTAKEIAKALRNKITLEEWLAQQKAAGEKAETPQQPPPQQPVPQQE
VREEAQKPAFPFDITKKIDEMLGTLEAEIYDENWTLVKRLPVRELPDFLTTSGDSIYAII
LDGITTQRIVDLAAKKGVKIIVTARTGPLTKVPENMQILTFDQLKKVE
Download sequence
Identical sequences Q8ZVU9
gi|18313106|ref|NP_559773.1| 178306.PAE2112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]