SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18313116|ref|NP_559783.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|18313116|ref|NP_559783.1|
Domain Number - Region: 38-104
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0283
Family L-aspartase/fumarase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18313116|ref|NP_559783.1|
Sequence length 342
Comment hypothetical protein PAE2128 [Pyrobaculum aerophilum str. IM2]
Sequence
MEEAPGCIAAVEEAVKPAVVAAAGLAGYAALHDGLYSTAVVSATAAAVVLAREGAFERAV
EYVRRAAEAAYEAAREVFEKARITLQRLYELFVEAVARVLDYVRAHWFIMAAAAAGLMAW
VVAQQLDYTLWQNHIALNAGAIAGLAKAAGVGDKWKEVGNAVLTKTASEKEIVERAAQLG
LDKGVVEKAVSAFSTLRHAMDEKQIENAVLELRRLTSYVQAMKAANYKKALEEASKAWYE
QRDPAALWALAVLGARETGKSVKVFEDDDDRIAYLIASFTLLNHLREFVELKNKSYKALE
RLEGAVKSGRFALSDVWGDLNVLVEAAERAKGGYQRAGQNCI
Download sequence
Identical sequences Q8ZSL1
gi|18312786|ref|NP_559453.1| gi|18313116|ref|NP_559783.1| 178306.PAE1657 178306.PAE2128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]