SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18313894|ref|NP_560561.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18313894|ref|NP_560561.1|
Domain Number 1 Region: 34-132
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000188
Family Polyphosphate kinase C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18313894|ref|NP_560561.1|
Sequence length 333
Comment hypothetical protein PAE3196 [Pyrobaculum aerophilum str. IM2]
Sequence
MGVEICRSLLECLGALGRSQRLYAAAGLVDEEGLEAASRAAGELRVLVGDSGPVPRPVYE
RWREVVRVYPSLHAKFYIFAEDAGPSAALVGSADLTAGGLRGNLEAVVLIRGEAARPLAD
MFNRLWARALPLTEDYVADWEGPEEALRKPWGEAVKRANERLAEILGVSAHCLSRHDPLN
CARLVARAVRSRFEGCGDLPENCAARATGVSAKALLSAPPSAVLAGHYVCWARALAARLL
EGKVGRLDSGMEAYEAAVQAGAESCWGEAKRAAEEELERLEDSNYRDNYVRWPIPYRLLF
LAMTLPATGCRILGREVRTKKRGVARVERELYC
Download sequence
Identical sequences Q8ZTL7
178306.PAE3196 gi|18313894|ref|NP_560561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]