SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18314049|ref|NP_560716.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|18314049|ref|NP_560716.1|
Domain Number - Region: 214-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00118
Family L-arabinose binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18314049|ref|NP_560716.1|
Sequence length 431
Comment hypothetical protein PAE3414 [Pyrobaculum aerophilum str. IM2]
Sequence
MAATRRDWLKAIASFAAGAVVGAGATYAALQSIKTAVERTTTPSPTVAEAQKTAAGLPVM
KVHFIYVGPIGDYGWTHAHDQGRRYLESALCPDPQKWCIVKTSYTESVPEEQAYTYIKKA
ISDGAHMVFTTSYGFMDGTKQAAAENPDRFFAHCSGYFKDQEEWARLKNFAEYFIDLYEA
YYLNGIVAGKMTKTNKLGYVAAFAKLPEIIRHMNAFLIGAREVNPNATMDVIQLGSWYSP
DNAKKAAITLVETSGADVLAFTEDSPTVLQVAEDYQKRGRRVWSFSHYSDMSQYGPTAHL
TGQIVNWGPLYVEMVIRAYLAWISGELALWSEWPPERPRDYWWSMKNAYSNYDYKKNPAD
IILPLNQAVPEEVRVYVEKRRREIIEGVWDPFTGPVRDMKGNVKVPDRARLSKDDLYNMD
WYVEGYGQLPA
Download sequence
Identical sequences Q8ZT65
gi|18314049|ref|NP_560716.1| 178306.PAE3414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]