SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978907|ref|YP_007689373.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978907|ref|YP_007689373.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily CheY-like 9.53e-42
Family CheY-related 0.00011
Further Details:      
 
Domain Number 2 Region: 142-241
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.37e-29
Family PhoB-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474978907|ref|YP_007689373.1|
Sequence length 256
Comment putative two-component system response regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MCAHVVVAEDDAKQAELIRRYLEHEGHDVILVQDGRAALDQIRRRLPDLLVLDVMMPGLD
GLDVCRTIRSEAALEGLPLLMLTARSTEDDLLLGLDLGADDYLTKPFSPRELMARIRSLL
RRSARTRTGSGTVSGAAGGTPDGALLTAGPVTVDPARHEVWAHGTHIPCTPGEFRLLEVL
AGRPGQVFTRSQILERLHGFDRYITTRTVDVHVMNLRKKIEEDPRRPKCLVTVYGVGYKL
SDDKRPSRPGGVRHER
Download sequence
Identical sequences A0A101PR51 H2JMW8
WP_014669165.1.21199 WP_014669165.1.28171 WP_014669165.1.57224 gi|386836632|ref|YP_006241690.1| gi|474978907|ref|YP_007689373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]